TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0J0H5|I0J0H5_COPJA ABC protein OS=Coptis japonica GN=Cjabcb2 PE=2 SV=1
MAEENGFNGDQNNHLQATASTSHSPAKLTNKTSGSTKSDQQDSDKGEGVEKMSAETVPYYKLFSFADSKDLVLMVIGTIA
SVANGASMPIMTFLVGDLINAFGQNANNKNTLPVVSRVALRFVYLAVGAGVASVFQVACWMVTGERQASRIRSLYLKTIL
RQDVAFFDKETNTGEVVGRMSGDIVRIQDAMGEKVGKFIQLFSTFIGGFIVAFVRGWLLTLIMLSSIPVLVISGAFVTIV
VSKMASRGQAAYSQAAITVEQTIGSIRTVASFSGEKHAITQYEKSLQKAYKSGVHEGLASGLGLGASMLIFFCSYALAIW
FGGRMIIEKDYTGGDIINIIDAILVGSFSLGQASPCLSAFAAGQAAAFKMFETIKRKPEIDSYDTKGRVLDDIHGDIELK
DICFSYPARPDEQIFSGFSLSLPSGTTSALVGESGSGKSTVISLIERFYDPQAGEVLIDGINLKEFQLRWIRQKIGLVSQ
EPVLFASSIKDNIAYGKDGATLEDIKAAAELANAAKFIDKLPQGLDTLVGEHGTHLSGGQKQRVAIARAILKDPRILLLD
EATSALDAESEHIVQEALDRVMVNRTTVVVAHRLSTIRSADMIAVVHRGKIVEKGSHSELLKDPDGAYSQLIRLQEVNRS
SENKAESTEFGRSSSHQQSFRRSMSRGSSGVGNSSRKSFSMSFGLPTPHIPEVVSAKPESTPEPKKQTEEVPLLRLASLN
KPEIPILLLGAISAAINGLIFPIFGVLLASVIKTFYKPEDELRKDSRFWALMFIVLGIASFVASPAGTYFFSVAGCRLIQ
RIRSMCFEKVVHMEINWFDEPEHSSGAIGAKLSSDAASVRSLVGDALSLLVQNAASAIAGLAIAFEANWILALIILVLLP
LIGLNGYLQTKFMTGFSADAKMMYEEASQVASDAVGSIRTVASFCAEEKVMQLYKKKCEGPMKTGIRQGLISGIGFGVSF
FLLYNVYATSFYVGARLVEDGKTTFAEVFRVFFALTMAALGISQSSSFAPDSSKARASTASIYGILDRKSKIDSSDDSGI
TLENLNGDIELRHVSFKYSTRPDIQILRDLSLAIRSGKTVALVGESGSGKSTVISLLQRFYDPDSGYITLDGVEIQKLQL
RWLRQQMGLVSQEPVLFNETIRANIAYGKEGDATETEILAAAELANAHKFISALQQGYDTMVGERGVQLSGGQKQRVAIA
RAMVKAPKILLLDEATSALDAESERVVQDALDKVMVNRTTIVVAHRLSTIKNADLIAVVKNGVIVEKGKHDHLINISDGV
YASLVALHMTAS