TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0YP29|I0YP29_9CHLO DUF1772-domain-containing protein OS=Coccomyxa subellipsoidea C-169 GN=COCSUDRAFT_54408 PE=4 SV=1
MEAVPMIASGLFAGAALSVSIAEHPARQDIDPEQAVRQFKKSYKQIAPLQAGLALIASGTSLYLASKSGDQSRKIYLAAG
LSMAAMLPYTVICIFPTNNRLMSAEKKEDAEVKRLFGKWEKLHAVRTIVGTLAFAGITIAALQSSKK