TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I0Z719|I0Z719_9CHLO Uncharacterized protein OS=Coccomyxa subellipsoidea C-169 GN=COCSUDRAFT_58976 PE=4 SV=1
MSGVENASGWLSDSSRESSHSGSHYVSVQSDGHSSLSTPTTAVSTTPLTQRIILQDSRQENIARRLAEGFAEDIELFNNP
IGSADGIHATASAGSPPVMIQNPEYSEDSPTQSFHLSASSVPTEVTLAALQVRHEGSLFAQQLEGSEMESTDVQAALPFV
ARSLPKRRPDDRIPAYMPRVALSTPLPLSRDVEDRITSLGPALPMEQKALLWLGIGLDVSSKASLCISLWRFAHRQRWLW
FGATLGFFTISSAVCVMYWMTHYPTAALDQDLRDSRSKFQRSDLYEARVHGLRKETFKRWVRRLGTLCAVCQLGTAFAAT
RALFSSEARQRLVEMDLRQGSPFLGMRLADTVFLTLGVCLLQVYIGMRCVHQSASCMYHLRGGFDWITCASIVASLSSSA
LCFLSLEINDHRFIKDRHAPGSLPLMAYQVELASFFMYRLAELSARVTLLALFANIYGFWTLLPLGLHAVAVVLLLRFSP
CRGQRRIWDKATASTQAQLGTAVKMPVPRFDDVKLLVACMAWPPSVFVSDATDAQGRFWWRSRMCGRRSACDVALKSRLV
PFPAFNTLIATEAACLLGLLWGAGVPAWAARYLGVAVLLHIAWGFLGMLWLACVHTCCVERQLDDLCRVAAQQESLHIKT
LRALLPRSNARLLPVLREDAEGSDGAWPESAAASSAGAAASDRSPEQQPAASREGSPVQALLSAIGVQIPTGDYQEDKLQ
GKAATVACDMSNPSRNSPDPSKTPSTVGTVLSIVASRASRGYSCITIIIIITRYYFSCISE