TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I1ZI47|I1ZI47_CUCSA Metal transport protein 4 OS=Cucumis sativus GN=MTP4 PE=2 SV=1
MGEEEVLILKTEHSDEINIPIVAKKMNDVIPTSTSSEVKCCSSGCAFSRLEHSNLESLKRSKSAMKLGGLILFYTIAIVV
EIIGGLRANSLSVMTDAAHLLSDVAGFSVSLFAVWVSGWEATPQHSFGYNRLEVLGALVSVQLIWLISGILIYEAIDRIL
APKTKVDGFLMFAVAAFGFLLNLFMVIWLGHSHHHHHSHSSHCCHHDHHSHSHQNHLEHEEEEVYTLTKQEGASLGSKDN
SSTLNINLQGAYLHVITDMIQSIGVMIAGLVLWFKPEWIVVDLICTLVFSVLALATTFSMLRHTAVILMEGTPREVHIES
LENDIKNMKGVYDLHDLHIWSITVGKVVLSCHVVAEAGVCSRELILKIKSHCEKRYNIVHTTIQVE