TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I2GQU8|I2GQU8_9BACT Uncharacterized protein OS=Fibrisoma limi BUZ 3 GN=BN8_05600 PE=4 SV=1
MLLVALTLTSLAVLLRIIANPLSNVFQKQLTQRSADPLFVIAATYGFLTLTCLAFWSQLQSANLPVAFWQSMLLVGLFAL
IGNVFLVKALQIGDLSVLGPINAYKSVVGMLVGIFLLNEIPSAVGVVGVVLIVVGSYIVLGNTQQRKGFSWGVFQRPEVR
LRLAALLFSAIDGVLLKKAIVLSTPTTAFFYWCLFGFLFSLVWIGLTLRQQWQHQVRLLFSQRTTYLALFLTVGLTQIAS
NVALAGMQVGYALALFQTSALISVVFGYQFFRETNIIRKLIGATIMVVGAVLITVFQ