TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I2H9Z2|I2H9Z2_TETBL Uncharacterized protein OS=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) GN=TBLA0J02000 PE=4 SV=1
MIFLILLLLQLININQAIANQKNKNNIIFINKTQLTQLPRNSSSIVLFTYESSSKKRTTDTTALEDEFKIISSAWTTNYN
ISITPIAFIQINIVDSETELPFKIPNIVIFPTNIIDVNHTIDIQKHFKTEEDRIHDIVDQISRILEVPAFQIKMPTDYVI
IFLRIILALNVSFLIYRHHKLAVNAVQSKFVWAFCSLTFIILMISGHMYKSVNKLGVFGYDENGMRLILLRNKLQKQYGI
ETYYIFIIHSILLGLVVLLTNIIPLIKPMYQNYKNPDKGISMSAIISITCSILIILVFSVFRELFQLKYELNRSLFNLQK
SDLNKSAI