TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3BVY2|I3BVY2_9GAMM Outer membrane protein OS=Thiothrix nivea DSM 5205 GN=Thini_2999 PE=4 SV=1
MSKYWYLAGTSILLASSLAYGGSAYAPYVGASVGYNTAVSESNLSAACGVGTSTCQDLGDTEDAWRVYAGYPITDKFAAE
LGYTDLVYTARLEEQANGIGVLRGEQKTKGVTLGLTAKQPVTQQVDVYGKLGAYVWDSKANTSLGSADDSGTSPTVGLGV
AYNVNEQWGVNAGWDRYFDLGTQARLIDGGKVGTVDEDIDTFSVGLNYNF