TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3CIB8|I3CIB8_9GAMM Membrane protein involved in the export of O-antigen and teichoic acid OS=Beggiatoa alba B18LD GN=BegalDRAFT_2518 PE=4 SV=1
MPAHLNWTLIDQAMVSLVNFLTGVLVARLLGIESFGFFALLWTILFFFSGLQIAFVLSPLLSLGTQQATEQADSYYSVVL
VQQLLFAILSSLCIFAGLWFSNWLFPAWHTAPYALLLALTSFTYQLQDFIRRYFFTLGNTHSAFTNDVISYLGQLAGLLG
LYYWQIISIHAVLWVTMLSSLLAIVIGLKRFRWQAWETHFFYQVTQRHWLYARWLCVSVLLERSHDAMMKAVITAVLGVQ
AVGVFRACQNVLGVTHVLLLALENFAPPRAGRVYIHTGKASLQQYLVKLTRYGGAVMAVIVLLLGGFPDSWLYWFYGDEF
EGYGAILSSYALVYFLVFFLSPLKIGLRVLENTRPLFYALLWATVVSLAILYPLTVWLGLQGTLLQLCLFNAIQVAYLFV
ALRLQLKS