TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3Z165|I3Z165_BELBD Uncharacterized protein OS=Belliella baltica (strain DSM 15883 / CIP 108006 / LMG 21964 / BA134) GN=Belba_0320 PE=4 SV=1
MKNIIILIFVFLMAGSLSAQDFSIGPKFGVSQANIEVNGDGFKAGDDKMGYHVGLFVRMGGASIFVQPEFLYTSTGGFII
DENNNATIETTINRLDIPMMVGFKVLKFFRLQAGPIASILLDQSFGDDPIAATQNIDYRSSTIGYQAGIGLDLGNLILDA
KYESSLGKIAGSVAGFETDQRQTQLVLSAGFRLF