TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I4B0V2|I4B0V2_TURPD Uncharacterized protein OS=Turneriella parva (strain ATCC BAA-1111 / DSM 21527 / NCTC 11395 / H) GN=Turpa_0249 PE=4 SV=1
MIRHVTLSLLLSATAFAAKNTNTTRINRQPLPANNLGAISIGAEVAIRLRDSSVIEQARVKSIDAEFLHITVREEYYTLA
YGTQYEEKVEAVRRARIYRILSKNKWYSDLPMSEDDHAGFRDYDDFARAKGDNVETADGEKYVGFVTAESDTEIIISMSD
GLKPIYRNAIRACRIRGKTCDIPGYLVPDYAGPAIVASAKGTKNFTEALEAAVPGDAKGKSFGVAAFQNASGNKTADAMA
ASLKSKAVAHLTALGYRVTDRDALTSVLKEKQLSQQGVLAGSDKTLDQTVQNDYIVSGNLESGGSGNYQVVINVVSTRSL
AVVSSKIAQVEATEGASNPDAYRHNGFHAKFMLGPGFASYGVSNVGSFDSLALSGTSFMVQLNTGFAIEENLILGINLGS
SFTSEPNISASPDILTEKRLSGRTLGLSTWGPSLTYYTRTNYFMTAMVGAATAIYEDTRQAVSVKNGFASGLAFGREWWQ
SENFAMGISLNLMYSSIALTDLELLLKTTGGDVKDSDFRMSQFGVYLAFSVAYK