TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I6B4D3|I6B4D3_9BACT Uncharacterized protein OS=Opitutaceae bacterium TAV1 GN=OpiT1DRAFT_00705 PE=4 SV=1
MKKILTALLALAMAGALHAQTITKSNTASLFGQRYVSADAEYYDIDGLNSVYGGALGFNLPITTDLDALFRYSYSWEDGH
TSREVQTAEAGLNTWFDVAPNLRAFAGADLGYTWGDAVSKDDWYGRLRAGAEYTIGSSISLLAYAAWSDGLDKHIPSLWS
GTGQASYWFTRDLAATARISWLEGGDLAYSLGALFKF