TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I6T2J8|I6T2J8_9ORTO CM2 protein (Fragment) OS=Influenza C virus (C/Alberta/3502/2011) GN=CM2 PE=4 SV=1
MGRMAMKWLVVIICSSIISQPASACNLKTCLNLFNNTDAVTVHCFNENQGYMLTLASLGLGIITMLYLLVKIIIELVNGF
VLGRWERWCGDIKTTIMPEIDSMEK