TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7LWL7|I7LWL7_TETTS OST3/OST6 family protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00558050 PE=4 SV=1
MNLKLLLISVFCIISVVLCGHIETGKAKSEALRELASKSPNGIIHFNSTGYRYFLLEQPRPYEVVLFFTAPKCDFCEQML
TQYELTSNYYYANNGHIPFKDSSKKLRAVYFGMMSFDQNTRETFLDLEFKSVPNLLVSVPQHALVSDQERNNFLKGFKWS
ISGSDGLVTHHKLLEYINKRTGREIEYQPPIHEVLRNLGILLILIILTIVVFRLYKSFFLNTKLWFVGSIVIYFVCIAGF
IYNQIHGVPMTTVDSKGNFQWMLDNQRMQLGAEGFVMSGLIILSALTIISYQLIARLNQKNIVNQLLLIAIFGTTFIIVI
KIEELYKFKGWYNINFFPPDHYNRGPIMKDQGNSI