TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7MMI0|I7MMI0_TETTS ABC transporter family protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00684430 PE=3 SV=1
MHKLSKGYSAYVFFEGQRNKILANISQNALREISQQTYEHLLKLDPSFHFGESQRQTIFDITKAQKAIESNLKSVSSFFI
PFISDVVLSSVFLLYHCGPFVFLSFLMTYGGYIWFTFDLTNSRRKGMGLQKKYERLADFTLSETLSNYYNVKYYSAEKFE
INRYTSILENYKNQTIENQRTLAQLNSGQRFVFSIGLTSNMIYGAYKVQKGLMTAGDIVLMQSLMMQVLQPLFFLGVQWR
EWTNSALDIQRLFKIMDTKPKIQDSPNAVDFVYKGGEIEFSNIKFGYSNDKVIIDNMNVTFGKGKWISLVGESGLYDPQQ
GSVLIDGQDIKNLKMESFRSKICVVSQNPYLFNDTVMSNLLYGSKNKKQEDVIEVCKKLNLHDLFMSLPQGYQTLVGEQG
NKFSGGEKQRISIARCLLNDAQIILLDEPTSSLDSINEDRVMKAIEQLRKDKTIIMITHRLHLNSYTNEVIYLTKDGYKE
QGKHSHLIQEKNTRYSKFWDNFVVLDHSDTNSVKVDQSENSLNEKPQKKQNGQKEEEEEKME