TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I8STK0|I8STK0_YERPE Putative exported protein OS=Yersinia pestis PY-113 GN=YPPY113_0868 PE=4 SV=1
MKRLLLSALLIPPGTLLAADAQELPLLSGGDAPTIKNSNLDLFGVSRDFGDIIFIDDDRTVNDSAPKRTRVFTGYEYENI
KFSNHPAQLYSTLVFADGSTKITDSFSMGYVLRETTIYDGPRNNAFAGSDKSRRDSFMEIQLLPKYINWVNENLSYGAEL
GYERFTDAKDAPEKQMYHIRPEINLGFGRNFLHLNAELGWIDRTDRGAYIETEPLYLYRVTDNFNIGAKAYYHAEDNDYR
WRETAIRPLIQYRFANSTYLELRWEIGGIRTHDGSGYNYNNYGLYTEIPFNPTISFMADLQYKDQKQHRGNEWSWGDKED
IFAKVGFILNF