TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J2DEW0|J2DEW0_9RHIZ Outer membrane autotransporter barrel domain-containing protein OS=Rhizobium sp. AP16 GN=PMI03_04363 PE=4 SV=1
MHKVLGSAAFLFAFGMASAAYTADLSVSTPPAAPIEQPVFTWTGFYVGLNGGGAFGGDDKFGLHSGDTFLGKFGKIEGSG
FFGGGQIGYNYQVDPNWVIGLEADFQGANIHDSVTNDGAHGSSKINWFGTLRPRVGYAYDNTLFYGTGGLAYGHIDYKGS
LDGVGSFSEDKTKAGWVLGAGVEHAFTDNVTAKLEYQYVDFGSFTAGGDALSSKATADFHSIRVGVNYKF