TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J5C9U3|J5C9U3_9BURK Hopanoid biosynthesis associated RND transporter like protein HpnN OS=Burkholderia multivorans CF2 OX=985078 GN=hpnN PE=4 SV=1
MVTSLIVRLVAWSVRRPVWVVVLSLLIAAFSGVYVARHFKINTDISKLVDAEPQWAALSQAVDRAFPQRNGTILAVVEAP
APEFATAAAHALTESLQKQAAAGRIGPVAEPGGGPFFEHNGLLFLSPQQVADTTSQLASARPLVNELAKNPSLTGLATTL
STTLGQPLLTGQVKLPSMAKLLSRSAATVDDVLAGKPAAFSWRALVDNDAARQPARAFVTVQPVVNYGALKAGAQTSDVI
RETARALDLEKRYGAVVRLTGEQPLADDEFSSVEDGAALNGVVTLLVVFVILWLALRSKRMIASVLVTLFVGLVVTAALG
LAMVGSLNMISVAFMVLFVGLGVDFSIQYGVKYREERFRDARIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRGV
SELGLIAGVGMFVALLTTLTLLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPILIGTLAVVIGALPLLAFLHFDFN
PLHLKDPHSESMSTLLALKDSPEAAVNDVTLLAPSLADADAAAKRLDALPEVGRTTTLSTFIPADQPEKRAAIATAASTL
LPALTQPPAPPATDAQRVAALKRASDLLGYAAEDHPGPGAAAAQHLSQSLAKLAAADSATRDRAERAFADTLRIALNQLA
ALLQPQEITRDTLPPPLVRDWVAPDGKALVQISPKVPKGVDPNDDTMLRHFATAVKAAEPGAIGGPISILHSANTIISAF
LHAALWSIISITILLWITLRRFGDVLRTLVPLLVSGIVTLEMCVVLGMSLNFANIIALPLMLGVGVAFKVYFVMAWRAGQ
TGLLHSSLTHAVLFSAATTATAFGSLWLSHHPGTSSMGKLLALALTCTLIGAVVFQPVLMGKPRVKRAKNQSQGINE