TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K4BVX1|K4BVX1_SOLLC Uncharacterized protein OS=Solanum lycopersicum GN=Solyc04g082440.2 PE=4 SV=1
MVSAGEIEFEQGFKMDEENDQSNRITTPIDNKDLVYELMGIIHIISSYAEFRRTQRKESRNLVRRMKLLLPLLEEIRDFQ
GKIPESGVHCLVKMKKAFHSAKKLLKTCHCGSKLYLALESEAVIRRFHSVYEKLSQTLDGMPYEELGISDEEKEQVELMI
IQFKRSKKRIDTQDMELAMDLMVSLSSENDRNADSASIERLAKKLELHTVEDLKAEMISVNEVIKERRSHNAENTQRIVD
LLDKLKKLAGMEETGPCDEPVMPKALEKSTSIAIPNEFLCPITLQIMADPVIISTGQTYERDSIQQWLDSNHHTCPKTGE
TLTHLSLAPNFALRNLIEEWCSKNNFQLPAKEAPTNPESPCAGSDEKLLSLIKDLSFSHLEVQRKAVTKIRMLSKENPEK
RTLIANYGGIPPLVLLLSYPDSKIQEHAVTALLNLSIDESNKKLISRENAIPEIIEILQNGSVGAKENSAAALFSLSMLD
ENKVAIGSLNGIPPLIDLLKNGTIRGRKDAITALFNLCFNHANKSIAIQAGIVAPLLQLLEEKHLDMVDETLSILLILAT
HPEGRQVIGKLSFIETLVNLMKDGTPKNKECSVAVLFELSTYNSNLMLAALQYGVYEYLVEISKEGTDRGQRKAKSILQL
MTKTEQIPY