TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K8EHG2|K8EHG2_9CHLO Uncharacterized protein OS=Bathycoccus prasinos GN=Bathy06g03940 PE=4 SV=1
MRNNNNTEYDDDENENEEENKVEEDKEEEEDAVLFSPDDDDDFQPVPSAVNTPMNAFQRRDQRYEEEEEEENEDRESTSP
MVFGRGRTHESDASNGQDFLAQTKKNQKDDSAKASPDGARSEEGEEDVETAKSGGGEMEDENVEMKSPLAFLFQKNKRRK
ENNKNNGTPKEYDRDSYRHGAMWASIGSPAFPHKNQSRVMNANNFNNDNNNENSDITTGMDDTNNTMNDAENKMNNNNNK
QVEFEDATESFGGSAGKATDFGVDEKINNRNRAKMRMSLPANLAQSVASPLPISKRVLDRIECLGPELARVQKIMLLTGI
FLDFWGKFSLVRELRRFSVTASWLWFSLVLIFFLISGCLTTSYWLLHYPMPEKPAKEDKEANAVVFGYTKYDFKVFVRRF
GAICAACQLGTAFAAWRALRSHDVRQRKAEMDLRGMQLVDCIFLSLPVATLQCYIGMMCSSPFATCPDRNGFDYVLFSAV
AGGLLSGTLCFVSLDLHEKPPAYSWREYWGVHKAHLSEMLAKFNFRFFELTARVVTIGLFASVCGAWVFLVFFVHILCII
GLMRIKLSGVPDRKKIWSKFVELKSVELPFQSAKRIAKNGGKKKTIRIPVLDDVKLLVCCLIWPPSCFVSNSTDKKGRFW
WRSTTCPRKTFWGLTREDALIPFVLILMLFALENGTMLVVVTHVAVDHWYRYLGMATFINFIWLSSAVIWISSAALWNPF
TPKGPPLAYPSANVAAPENYRLSSISSFKDKKSSMGGRRSGVKPFARRSRAWVSPTASPVIEVDETGNSNNNNAYGENID
EKFNAAAAEATTTSPIHEYDNNTHRIDTFRDHGVVETMNERAGDEEMAIVRSPDVIVDINNTAYKVEDSAGEEEDEDMES
FQTNEPSAFANMIDRTGEHEMLRRSLQWQRASEEMKKSVTDVKMRAETDLAAARAAMNFLNRESVESAQGESDKNYAEEE
QEEDDDDDEEEEELNRTMSSDAYIESMQKGRMTNEVTGDAYVDAMRSPGGSIASDGNSPLGKMNSMNSPREQEQERGEEE
REVADPWGFDENKLKIENSVDVDDDDIVNNESPTTFPSRRNSGTLQTPMFSPVAQQPKYADEDEDEETKQPNATFCEIL