TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K8GL81|K8GL81_9CYAN Legionella pneumophila major outer membrane protein OS=Oscillatoriales cyanobacterium JSC-12 GN=OsccyDRAFT_2756 PE=4 SV=1
MLKNNRVSLAVAIATVLSSSMTAIAQEYSELEDPQSPNQAIPDPDTNSLSDTPTSYHQAAVESSSTVEFSQAPYAREFEQ
RSIVVQAEPSVDPPIEAVSAPSVPVSYQPQVAQPIPAAKPAEIAKPIQVAQVVVPTVPATTISDRPAVVPTHPLAAQQPE
THGRSPVSAVETRPTIEFSQASKAVPVSTVVVDVDAVQTQTPVTPPLLPQGTPDSVNPVQTQLQQLQQQQRQLQQQINNL
QRQMQPQPNGSVVVVKDNNPSNLRVTGEALFWNANPADAMDYAIADPGTALATSGDLKTVDYDNGTGFRLGAIYRLPNSG
WDLGGNYTNFNTQGSSSAVAPANGFLFSTRSHPFQNETADTAAASAKLNYKAGDFEAGYNIRAGKNVDLRLFGGLKASNL
NQKMNINYDGRDYTNGQIDTENNFTGVGPRVGLEAKVPLGAGFNLFGRGAASMQVGTQTSTFRETDRNGADVIADLRRQQ
KGQVVPGLELAAGLSWEKQLSKQAKIEIGGGYELQHLFNVTDNVRFVDAASPGVFAQNKGDLSLKGFFLKGGVSIQF