TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K9HWE0|K9HWE0_9PROT Uncharacterized protein OS=Caenispirillum salinarum AK4 GN=C882_2615 PE=4 SV=1
MRRENPGEVTTAERSGIMKAFLLTLLLAGGTIILAGCNTMEGIGEDTQAAGQALEDTAEDASD