TCDB is operated by the Saier Lab Bioinformatics Group
>KHN35905.1 hypothetical protein glysoja_038276 [Glycine soja]
MKIEFVQFFTLHYQKKELGRMGVQQKLISFLFHTCLVFIMFSLVSSSQEHHQITSSPSKTKDSNHIKMSPGLQFQITLHG
FLLWASMGFLMPVGILAIRLSNREESPKRHRILFYGHSILQMIAVLLATAGAIMSIKNFNNLFNNSHQRLGVALYGVIWL
QVLLGIFRPQRGSKRSVWFFAHWILGTAVTFLGVLNVYLGLGAYHQKTSKGIKIWNILFTVQISLIVFFYLFQEKWVYIQ
NQGVVLGKEIKAPICQESRPDEKEKVLKGDTC