TCDB is operated by the Saier Lab Bioinformatics Group
>KKF23875.1 hypothetical protein EH28_19269 [Larimichthys crocea]
MLAHAQQQQQLVKMGAGAPESAEDMKKFKAEGEPLSLPQHSYWFDFWAFLAFDIVFFLVMYFIVCPWTLEPGDMECSSCP
VLSCPAVRNTNQL