TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40959.1 hypothetical protein Lokiarch_46850 [Lokiarchaeum sp. GC14_75]
MKNEKKNMKKTTRSIAFFLIFSTIVLPILPAFTVAQGGTVIFRRSTASLVGDWDPAITDWYNALVGSYLYNALEYPIGTP
IYSSAGLDYPIGDEWIPILVTDWILEPWPEENNSVGFVNTGGYKSTTFTLREGVTFTDGSAWNATVFKWNIDRVHLINGN
YTGMAYGNDEWEEQEGNLLGTMLVEDNKAYFTASWNNSEYDSPNLGLLEPSILPDVLDYAWYDLGPNASLVDYPGVTILA
NNTVRNPNPYGGWDNVSSAAIHWAPYDRYPGVAKVEILVNQASGGTIKVYHNTWSSAMGTFVNYPMLSYQAYKDEYTVHG
IYGYENGVKDASNPTIVDHMIGTGPYVYVEHDETGTPPGGYLLKNENYWNKTALEADGLFEVDRVEIIKFPAGELGADAQ
NTAMLTHAIDFAWDSMFQPLDYNAVVNNPNIRYEEQAASEYKTNVVLNAINETWWAWPWADAFRKGQYPMAGNFSAGGVP
QAMRKAMSFAFNYDLMITTVLNGRAVRNGGILGTANLYYNESVDIADYNVTKAREILLTTEADTSGEVFTLYGAWEGYSP
NPDLYNFSKMVATRGLTASSPNADWVWVAENNPIYTFNFYYDSAHQDVYNVMVASFKQIGVALVADVSNKVNTIIWDTVR
IGHLTTFDGDHSLFSVNGWVMDEHMPHDVPELNTFWHYVDPDRGRWRTQALGAGSAGITSWHYWGNFGFNFDARVDKIYD
RIVMSNPTERKQWYSKLAEIQQNDKYGVMFLYEAREGWAMWKDFETFIVADKEGWLSGLYGGISNHFLRYVGLSVEYPLI
PGSPLLITLTVSVVSTLGIVYALMRKKKLR