TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40960.1 Dipeptide transport system permease protein DppB [Lokiarchaeum sp. GC14_75]
MSRQSRNMIKYIIKRILLMFPILIAVLIFTWVLSQSMSISPLNKIPGNIIDRARYEAELRRSGWLDPWYVKLGIYLGRFF
TGDWGESFLLAEGTPVITLISEIFPKTIEMMLFSIIIVPIISVKLGVNSAKYKNKPRDSLIRGMAILGAGIPVFYIAILV
QMFIGMTIRDFSHGWIFLEVVYPNNPILDSPIPQGGVGTGFRLIDSVLYNDQIYLWDTLLHLILPVFCMIFVSLSGVTRQ
TRSSMLDVLDQDYIRTARAKGVMEKDVINKHALRNAILPTSHLVIGGTAGALLGSLFVEVTFNYTGFGYNMYLSIILGDY
LVINGLLVFSTIVVISGTLIADVAYTIIDPRIIY