TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40961.1 putative D,D-dipeptide transport system permease protein DdpC [Lokiarchaeum sp. GC14_75]
MTETSLEETEGYQRPVANNKKFFRLIKFYLIPGWREPEFTAEEYEIGKIKSKRKLFRRLLTPLTIAGIVMILFIGFLGMY
APWLTTFTLDNLTPPDYLPVIPYLPPSPLHPLGTTQYGFDILGRLIWGSRTALTAAALPVIIGTLGGLAVGTISAYFGGA
IDSIIMRFCDFWFSFPVLILVIIVSPLIGNSLYNILILYGLFGIPGATRWIRALVLQVKQNVYVRAAITSGAEKFKVMFK
HILPNAMSPIIIGFFGSMGGAILGFVGIAFLGLTDQKTADWGTDINFGSGQWGAYYAVFWPGLFIAIAAVGFMLIGDGLR
DALDPRLHI