TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40962.1 Oligopeptide transport ATP-binding protein OppD [Lokiarchaeum sp. GC14_75]
MTGLVVLLLILFVIINFSFENIDLVRTYRLSSLTTSLIVFGISIVLRMLFETLGMWIKIFRILNNDILYFAIMLTIFFFL
HKPFLRKFGFSEISNEDRPQNQRFNKIIIIFIGIAWFISAIFLSITILGISLRDPLFPSYSDKFGLGVFWSFTLVLICII
TTSIINKSLPIEKRISKTVLKSAMYGGGFFAFGLWFIQLVIFEVYINKWGGFQIIIQDIRVLAVFVVGLYIIIFFNLLKS
KLLPEASEKSSKRVKELLFSELKKQSNSRNINETELGLENQDSFSNVSEDKIIHFPQGISLKIYAYIFKKFNKSNSLDDK
TLSESKFNNSFNKIIVGLIWGYPIVLILIVRLLLPNTLTEILFLSSMCALFMVVGDLALIFLFNRLNPVGKRVPNILLQH
TALFGGMVTFWLWIVPFFVIYLYLFILITDIIILNITYLTILSIVMFALGTKILLWYATSIKMWDAATKKAPFVKKKASR
VNLIWLIFNIPLRVVLFIIFSRAGIYYSNILSNFWADDVWPTKYELLIPILLNEFIIIVINLIIGIVIVLKVYRRKLGES
FKFLISSQIVIFLVTILVNLFLGLFQSLITSYHFSLQDPRIPLVVATGIYIISVFGFLKIKLMTDDTSEKMKDKFRAALK
PFEEEAQIQESTAVGRKIILDVRNLTTYFYTEEGVVRAVEGVSFTIYEGETLGLVGETGCGKSVTALSILRLVRPPGEIK
SGKVFFEGEDLHQKTEQEFLKYRGNKITMIFQDPLNSLNPVFKVGDQISEVYRLHMEDDLLIEAVKKNTSIYDIARKWSQ
KLLKDLNIPMPRIIFDRYPHELSGGMRQRIQIAMGLACSPKLLIADEPTTALDVTIQNQILKLMKDLKKKYNTSILFITH
DLGIISKMCDRVAVMYSGLIVEYGDIEKLFVKPYHPYTRGLISSVPVVGKKREVLEVIPGTVPNLIYPPSGCRFHPRCQY
CFEPCDSKVPKSIETEPNYFVACHLYDPEYKDLAEISIGKAESKASNV