TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40963.1 Oligopeptide transport ATP-binding protein OppF [Lokiarchaeum sp. GC14_75]
MAITSNLTVGFFISEIFFGLLIFLYGIYFIRSYLNGKEWGDNSLNPVIIVNLIWFVLSLVFKVIYLNFIGTSVLVSQISD
ILRIVVGIGLTSFIVSKYYNIKFTESLIPSTIIQVVMYGMATLLGILVNVSNIMVTGSEKMYGSGLMFFFIGILIFGINS
FYINSGDKAQFIKNRNTIILITIIPGLYYLRDLLIIQRESFTAAFFGNLVWGVAITVITSTIVKLFVQSTLNFEKYRDIT
ILEKNKKLLEVKDLKVHYPLIGGMLKRQFGSVRAVEGVSFSIKTGETVGLVGESGCGKTTVAMAILGLVPKTAGEIIFND
EPIPNNFTKQLRKKIQIVYQDPDSSLNPRMKIVNIIAEPLKNLLGITKKATIRKRVLELLDEVSLKREHMDRFPHEFSGG
QKQRIIIARALASNPELVILDEPTSALDVSVQAQILNLLKNLQKTYGYGFLFITHNLAVVNHIADRVAVMYLGKFVEVGE
TDQIFLHPTHPYTQALLASRTELDPTNKEISFVIKGEVPSPIAPPPGCTFNPRCISDAKTNECMRELPHRIEIEEGHYIW
CVNPPVSMSKSTSKEGADLKALDN