TCDB is operated by the Saier Lab Bioinformatics Group
>KKK41372.1 hypothetical protein Lokiarch_43620 [Lokiarchaeum sp. GC14_75]
MNIIVIELIASIYIIIIGIAMLSMWIFLLGKREVPELTTKPTQIYFHLAAELLTSITLIFGGIGFILNQPWGVALFFISI
GMAIYSTINAAGNYGQLKDWPMFIILNVFTIISLIFATMIILIEFQIL