TCDB is operated by the Saier Lab Bioinformatics Group
>KKK43087.1 hypothetical protein Lokiarch_29820 [Lokiarchaeum sp. GC14_75]
MVETYVIPTINLVVMAITTVLYTLGCVFYGTRKFSKKLHPLFSFSGWIGTLIFFFIYMLGRSITRSLSAPDYLSALYIPT
LIIHMVTATITLILPALLLFIGLKRRKGKTDRSMKKIGIINVILWYITFITGIIIFLCLHIL