TCDB is operated by the Saier Lab Bioinformatics Group
>KKK43438.1 putative ABC transporter ATP-binding protein [Lokiarchaeum sp. GC14_75]
MSKFFGLGAEDYDRIYSDRELFSRILKLFKPHRRSMIIVIIFITLSSVTYGLIPYLMSLIIKQLESPSSLSFLIFFIINL
FLLNSLGFVFNYVNRRQGNRMVYRVCYNLRRQTNLRVLEQDLSFFDKFPTGKIVSRINSDGQKFGGSVTLFTELISSFLI
FFIVLIPMLLVNPLLTGVFMLMVPIVFLFAVSFRKVARKKSLYGQRSLAQVNAFVQESMAGIQIIKSFRQEKSQFATFQA
INNQSFKVNMSRALFLNILFPSLDILIAVLYALLIFFGGNFIVQGTLDAGDIYLFLQSSLILFEPLLQMASFWPQFQDGM
SAAERIFALQDSQSYIKQGDYITEKIKGEIEFDSLEFEYSSKKPVFKDFNLKIQPGETIAIVGHTGAGKSSLTKVLLRLY
EFQSGDVRIDGHSIRDISLKEYRRQIGFIPQTPFLWADTIENNVKYGSINATREQVIWAIEQTGGIEWVNHLDKGLETYI
LERGKVLSMGQRQLIVFARVLLQNPSILILDEATASVDPFTELKIQEAMEKIMKGRTTIIIAHRLTTVKNVDRIIVIEHG
KIVEEGNHNNLMKKKEYYARLYNTYFRHQSYEFLSTIKNK