TCDB is operated by the Saier Lab Bioinformatics Group
>KKK43635.1 hypothetical protein Lokiarch_25570 [Lokiarchaeum sp. GC14_75]
MSVESGFSEESLREIARVKVNFRFSVLIHYAVFIFVSILLLTINLLFSRLIFWIIFPFFGWFIGIVMHTVGYFVYARGVY
PLAKRTVIFHIFAYLSVMLLLFLVNLFTMPENYWVLFPAIFWGIAVIVHYTIYMIYFKRRIDEPRKNLSRREKAIEREMK
KMREKINR