TCDB is operated by the Saier Lab Bioinformatics Group
>KKT89443.1 Ferric reductase domain protein transmembrane component domain protein [Candidatus Moranbacteria bacterium GW2011_GWC2_45_10]
MKRIFTFFMLIASLFSVSSISFAQEMRAVEYPAGYAADVDLDGLTDEGEKQLFLTDPNNPDTDWDGYFDGLEILNGTNPL
DVNSYLNPREVTGVSMENSWAWYITRATALISFALLYIVVFFGLTVRLPFLNKIFSPLASLRVHAWLSVQALAFAAVHGI
SLVFDKFLKFTIADVFIPFSSYFETNMVALGVISFYVMLLLILTSYFRRLMSHKIWRISHFLNIALYVIVIIHALNLGTD
LKSGTGRDIFIWSNFFLGMLFVANLSYQLIMVIKRNVAARKIDNLQN