TCDB is operated by the Saier Lab Bioinformatics Group
>KRX01930.1 hypothetical protein PPERSA_05769 [Pseudocohnilembus persalinus]
MLSQTHIKIVKILMLLCKYIGYLYFALNYLFATQYFLSIEPSKYNYQWMGLNNVEDFIKNWEISPWQLLSNLILIFLCFW
VLDIIKYRQISQKIKKIIENDRQQLNQAVDHQHVKEEKSQFSDEDDEESIYGIQREGTKLQGDKLGSQNQEPVQIKSLSQ
SQSSFKSSYERPLDQDQVELFQKEGDNELNKEHKEKEQKKQKQLQTKAYKVMKKSVKKAKKVGKSIARGAYRYFKKFISM
FNSYLFTTRILQAGCIITISRYNNYYSLLQIIFMAITGFTLDGRILRASSVALNLPALLATYITMIWANFGDQIGDVSDM
NNYLGFKTYKHFWEESLIINGVIFLNVFFIRQVEQHIQAKNLKVKRKKEGMKSKGKKNEKKKSNEVGWMTIIGAFLLKIS
FIAALFILWWISLSAVNLINLVLVILLLVFFSNITTTVIVKYFDKKKNEEKEREVTFNRKYWWIIKVFLDIVIFARYFYY
LQFNDNIDDTDSKIYQIINFIGLNYDYKFNFPYSLNSQDFADESIFWTLYIFVILQSDAFKSQIYYKYSHKIIDIIACKK
IVIKFFPSLRQFCKWFEVFFFTLLVWLTFSVIVCIYMYVRFNLINTVLLFMTFWMIVYYVISSKNEGKLNYLKFRRMLFT
LILVQVFVLLIRYICQFTSNAYVKNFVIDPDSSGYKFFEKYRQLIGLYNEVTEGELRELFIPGMTILFFGIITLDHVSFL
SNGFLQNKNLGDQEKKMLESRTMSRISRMSSVSGSSFQEYIDFENLQQKQQLEYYESFKNFVQTEITEELKWMKPICKFV
SIIITHVNTLLVLIFAMYFRTAVSMFILLSIYLYYYYKTNSETFKLIVREKVYEKLSTRIKQFKQRYVLFEAVPEQLTEA
DKLNKKTLREYQRNETKMKLDINLNVWTLSFYFTLFCAFFSYCSQFLCSIFMVEKFNSFSILLQQILFILGIQVVALDED
IKPEDMKNLEYISDPSAKYVVNQTWFYVMIFWLTILELRGIQFLKEQIQKEEDKELELDMSFSQSQSHSISVDIKEGGRI
QEQNLDLQKKQSKSASSAKKIKPKKEEGVILEEDSQEEDEDEDENDDYYLEKQLGDEQQKKLFQVSGVESDLSYQKFQIE
GFQSKNLINDEFIDVQKAHKLVLYFKSKLRYMNTTLLLSLVVFIQRICVMLILINSDVSSNIFSWVYMGLGLYFWVISNN
PHSIRTMNVSSILVVLLQYSLLLLNINSDTAQIPMPAYLYDKTSLSLIEHLTSTGGENDWLQFFGFQSNNNQVTFVVNAL
IVFFIAMFFSIFNFLARKIVSKTQNLNLVKNLKVRFWLNFQNWRSGSFVIMNAIYEGMLVYGHVVLLLLLIIASTYNYSI
FNLLILISSLGMLFYLEMILPYPFKQDHIIYLLKYLKGLKIYLFGLLFIVALYKIPFINEEFSKEFKDDSFLAQQIIHFD
IIDKIIMLFMITVLNDILEANDYGYVVNKNAESAQITGKMIAKCMVFEKNDQKIDNLIKEIKSQVILKREVQEASEILNK
WHKQVEGVQAKKMQQQQEKQQLNSQSQLNAKTSQANMNNSQSELSQINFDDQNQQQESEDDEYLAYKKQKEDQENKKTEK
KKDKTKIQLEVEEYHKKNQMNAFRKTVKKVKYWLKSFLVMSINFCDNHKNKYLFLDEANLLNKYLEFNDQFLDCYLFEIE
DLVNENSTYTKNVLEFIENFYKYLFEKIRENSNNLIFNDMNIKEEMIKQDKYNDQDVKVLLENEMEAIGLSYGKQSETLK
KVKIVDSQRIIRLYNLIHKINKEVRTNSANGLFEKFLTSFCQLLISQWTIIVFIFFVLYYLYNQGLVSMILPIMLFSYFI
LIEGIANYTLWNISFFYSSFLIVFKFSLCLNGIDYLSETSVFQSFFSGGQSLKYEGVIFAILFVQVAILKRMGCYYQNYT
QLESTHQGYIRNIINKKISFEKSSLLLNSYFSEKINPQESILYENSEKNKSDNIFKENFKEQSDHAVNQIIDDKITQNKD
IKSDVDENIPEEIEESKQQSEQAGKLDLQQNKMDTSIRMNEPESVVRKRPLSQQANNQPKKSYFEKSSALSKISIQSSKL
EKKKSRSQMTRQELIEKRLSSKEIIKVEFEEDIKSNPDLLKYDRNFGLFYAFTDVYIKKVGIDLYPLTVTVQILALIYVL
LFYSKMDTSLGTSDLEGSVSTNSIPGQQVIVLLIQVVFIVFERYITLKQNVIVPTEKKQQEETQLETIKEEDENLSSRHN
SDFNKAQGEEQSEIHEKKHKSQQSIKSHSSSNSSQGDKFEEKDSDKELTELGELESQEESQEEFQRFKYVGITKEWLKFI
LLIVTMIFVFYFVFFHCPEPFSIDTSYNSSSVYILNQTGVYYQTTGYLIFFFLIYCVYFLLSGIQIRKGYKKYKRRDTLY
QYENLPANILVKTINGVPFIQEIKIVMDWTFTKTSLDLFQWFKLQDMQYYLYYSKMESKDRMKRKPGQPVDKILKIAMGT
CQTILLLLLVFGPLLIFSNLNPVTEPNQIVSGDLSVSLLILDLKNPGQQNEQIIGTNQYSLYSTGHINDLKNVNRSNKDG
EVWSENEYGQIPLLKNSQEQQFQQFNYAPYSDDQWTLSYPAITYIKQQITKYLNGKEDSSTGIGFQLVVDYAFQREQSQI
ASVPKSYNYPEDVANGDLGTYLNRDQVLILQEMLNECKSEHLYLKQFYIDTLVMYTDGDTTKPHLLMAKQSANDELMYQQ
NVSLNLRCINPQPNKDGEVIIPDGEDPSTQKYWTLSLGESLTDNTLDLQGLPFYVYTDMYSKAAFGFSLITIYTSVILII
GTYIKGFYSGQIQLLIYMEIPKPDKFLKICHAIQIARIENDLIQENLFYYELVDILRSPEILKLLGESWAIKQKKRLDDE
HPQKIKTE