TCDB is operated by the Saier Lab Bioinformatics Group
>KXH70094.1 hypothetical protein AM326_04520 [Candidatus Thorarchaeota archaeon SMTZ-45]
MPKNMSKLMDVIFICSSIIFNTSVSVLYIATKFDNMILVQVCGAIVLSLIIPFTITLLGYVKEKTEKRTTISHAFILFYL
FLELLLDYILKIPFRDILAIHVPYIIVFYAAMFSMIGVSFDRNRKMGFVVTITFLVLIGCLVYYLLP