TCDB is operated by the Saier Lab Bioinformatics Group
>KYQ99820.1 hypothetical protein DLAC_11561 [Tieghemostelium lacteum]
MILFNILVADLPSDRDAIPDTKALTNGSLFHGNFYKYGDMWLALTFWCTISCTLSYLLSGFIASVVMRKSKLSPFIPIVT
GMFGMAIGICYGGLAALIISAIYLSAKFLMSWFQAMLWGIGLTLLQVIFAFTLRFLAV