TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L0G408|L0G408_ECHVK Uncharacterized protein OS=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) GN=Echvi_3806 PE=4 SV=1
MTKGKCNSCFGGASFYVGKGLSVTVLFLILFIQLAQGQVLPLNQSVFQDYIRRQQVMDTTSGALSFNVRPLYLDKIEEGK
YKDLLTDGLFGEVVDRKSFSLRVLPMILSHSYNSNYPYAGGNGAEVPAKGQQLLWSAGVHLQTGPVSIQLYPQFHYAQNL
PFEEYPGEAPITFFEFMERGVDGVDLPVRYGDGPISELLPGNSHVKVMFGGFAAGVSTENVWWGPAKYNPLMLGDNAPGF
PHATLHTTKPVRTFLGHFEGQYLMGRLEGSGHTYYSDNAFSSVFKPIEEDDWRYFTGISISYSPKWLPGLSVGASRAFQI
YRDDMGGNLRAWMPLFSPLPKDGEGVLEHVNRREDQVLEFFFRWAVPEAHSELYFEFMRTDHSYNWRDMILNPEHSRGFV
IGASKYIPIAGDRFIGINLEMTQTQNPINNIIRWDGLPNKGRGLYDNYQVIHGVTNKGQVLGSGLGRSGNIQIFEISHVK
ELQKIALQLERYARDQNFYHYANSNGEQVAPWIDFAVGGKYEGEVMDHVCLQAQLRLVKSMNYNFYAPYYNDKDGRYRGD
PALNINSTIVLSYIF