TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L0IDC2|L0IDC2_9EURY Membrane protein involved in the export of O-antigen and teichoic acid OS=Halovivax ruber XH-70 GN=Halru_1619 PE=4 SV=1
MSVTDRIVRGFKATLAARVVDALANGLLMVLLARVLLSPSEYGQLFFVLAVVGVAQLVADLGLSRSAARYVAERKETDPG
SVPFVVRSSLRYKLLLIIVVAGGLVLGADVVASLLGTPAVAGVLGLGACYLAVQSLAAYAEILFQGFNRLELSAVVKLTN
NLSRLVAVVILTGLGFGVAGALLGYVAGAFLGAAVGLGYLFGRLYRSFEDTGGSRALRNSILAYSVPLTASHSANVLDKR
IDTVLVGALLNPLAVSYYVLSKQITEFVLVPAGSLGFSVSPTYGEQKANDALDHAARIYESTVEVVLLLYVPAAVGLIVI
AEPAVRMVFGSAYLGAVPVLQVLGIYVVFQAITSVTTNGLDYLGRAKHRAIAKGTTSIANVLLNVVLIPIYGVVGAAAAT
VVTFGAYTAVSVYVMHRELSLDFARLGRRLVLVGGISVGMGLAVVSMRPFISTVIGLVGVVGLGVCVWMALAVASGLMDV
QETIGLLR