TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L0JEP6|L0JEP6_NATP1 Leader peptidase family protein OS=Natrinema pellirubrum (strain DSM 15624 / JCM 10476 / NCIMB 786) GN=Natpe_0069 PE=4 SV=1
MTLAGTVATGPDLLRLVAVPVFAWTAYRDIETRRVSSTVWIPLALLGAVLLLWDARLAWAAGGTVWSYDFLVPTAISLGL
VVPIAYLFWWIGGFGGADAKALLVLAVLFPTFPEYALGTVTLPLEPTRIGAFSFTILTNAVLVAVALPVVLAIRNAAAGR
IAPVMFVGWPVSWEQVPETHGRLLETPTGLSRGGLDLDALRMYLRWRGLSLAQLRDAPERYRDPATLPDEPNPPTDGAVT
ADVDLRGDGGALEGAETETAATAAADSQGAPAVDDPWGAEAFLDDIEGSAYGTTPEALRDGLEVLHENETVWISPGTPFL
VPIFAGLVIALIYGDLLLGTLL