TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1J207|L1J207_GUITH Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_111593 PE=4 SV=1
MSSITCDPAIYGEWSRENQFCVEKSLITLDGIKYVQLVMAVVSACQVFFMVTRAPKVPWEAIYLPTTEMITYSLAFTGNG
YIRVANGKYLPWARMASWLCTCPIMLGLVSNMALVKYKSIPLNPMMIAASSICTVFGITASVVLDPLHVWLYCFISSIFF
IFEMVVAFAIFAITIHDFQTIGSPMSLKVVERLKLMRIVFYVSWMAYPILWSFSSTGACIMSENTSSVLYLLGDALCKNT
YGILLWATTWGLLNGKWDRDYVKGRNVDGTLMPEYEQDLEKGNTERYEDARAGETFEVKMFGRTLTSVRRSRRRPRRDIV
FNGGDRNRLSDSDSERRRRRKKYQRKDSESENSSDESMGSEHEKNRRKGKKKNKENRRSAPPKEDSTSDTLRDAEIKRIM
DLMKRNAGSDIPGLDGDGRLRDDGGLIPTRNEEHDDSA