TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L7XA38|L7XA38_WHEAT Protein DETOXIFICATION OS=Triticum aestivum OX=4565 GN=MATE1 PE=2 SV=1
MEEGAAASMTVGEKRVAVDVPAGAAAAANGHGPEEKAAEDVPAPSALSGWPRTTGMYLFVMNIRSVFKLDELGSEVLRIA
VPASLALAADPLASLVDTAFIGRLGSVEIAAVGVSIAIFNQVSKVCIYPLVSVTTSFVAEEDAIISKYIEENNSKDLEKA
AHVHSDACNVPASGGDTPVCANSCIPTECADPSNQGCKRRYIPSVTSALIVGSFLGLVQAVFLIFSAKVVLGIMGVKHDS
PMLEPAVRYLTIRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATVVGDATNIILDPILMFVCHMGVTGAAVAHVISQYLIT
MILICRLVQQVDVIPPSLKSLKFGRFLGCGFLLLARVVAVTFCVTLASSLAARDGPTIMAAFQICCQLWLATSLLADGLA
VAGQAVLASAFAKNDTKKVIAATSRVLRLSIVLGMGLTVVLGLFMKFGAGVFTKDAAVIDVIHKGIPFVAGTQTINALAF
VFDGINFGAQDYTYSAYSMVGVASISIPCLVYLSAHRGFIGIWVALTIYMSLRTVASTWRMGAARGPWAFLRK