TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8F4M3|L8F4M3_MYCSM Uncharacterized protein OS=Mycobacterium smegmatis MKD8 GN=D806_6010 PE=4 SV=1
MLGRALVFAAASTSAFQVANINVTALSLLCLLIAPAWLLMSHRGADLLPLVLAALGWLSFLASCLVNDVSMLWPNAMAPA
AFGLYFIGLTVLTARSVDAIAFVLAGLAVGTIVFFSTEGIELTNTGHFPDLWKYGIASAVTILLVFGLTMVRVPALILPA
ALGVLGLASLGLNYRAHALVCFLAAGTLLINHVFGSWLRRGWQFVGLIVIGVAFAYFMPMVARTGMLGSALQRKTLEQEA
FNVPLLLAGRTEPPMSITAILERPLVGWGSAMNLTPDVYTSAQHLATRLGFDPTFPFDVYWELPPTNYSAMHSILLGSWA
EGGVLAVLLPAALLVACLGIVWNFTRLGRWAPLGVTVALQGIWDITYGPWLYNMIPTFVCVALLFSATHFRGEPVPSDGR