TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8JIE2|L8JIE2_9BACT Uncharacterized protein OS=Fulvivirga imtechensis AK7 GN=C900_00157 PE=4 SV=1
MVNEQQMAKIISDFGKLAIKYEAIPVLLCYVLIALLPFDLFVISLIIILLSVSALMICDKTRWWLCLKSGWKFYLPLLAF
YIYHVIGLGWTSNYHEGFRSLEYKLSFLVLPLIMALINLDSRTILRLFNVFIIINLVLVILSFLHFIFIDITQDEFIILG
EKVEGNRVGTRGEYLSKHFLIIDQHRTFYSIQLVISVWFLLNYIPFLRKMTKKKVIAITSSVFILISGILVMQSKLSYLL
LALTIITSLILHFKLIPKSALISALLVIIASLLFTNELITDRFEKMVDEVEYIFSDGDDQTKTFATKLRPGSSEIRYMLY
KSSLQVISESFLFGHGTGDVRDMLKEQNYKNGYISIAHLNYGAHSQLLHSSIAFGIIGIILLFSIFLIPLSSEIKKRNYF
TCGVLVIFLIACIFESYLNSRAGIIPVAFFIPLLSHFQFQHFNKK