TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M0P6L1|M0P6L1_9EURY Uncharacterized protein OS=Halorubrum kocurii JCM 14978 GN=C468_05738 PE=4 SV=1
MLRGTATALTRSADAAGVLVVGALLTLLTWVVTPLWVGGSLVFPPVVLLAPLALAPAFVARGYFVRVLAAGIADGNVAGA
PPFVAWNELYRTGLKSALLSAVLLAPLAAGAVLAALATGALATGVVDPGPLADAVRAALGDGGAVAVVGVAGGLGGAAAT
AYLLAFAYVRPAALAAFAASGRLRDGLRPRRVGRVAGSGAYATAWVVAAATLSAGYALAGPFVPLVIGVAFAFVVRVAAY
GLYGRGAAPTLEVAERADAAASVADAHASDPARVDRPDEPVRPPTPEVPPTVQTGRSVPVGGTGARRTDGDGTVSEGASG
AVGADGGFDWYAPDGEPGDRDRAVADEALGGRDPDDEFEWSVDVAEPEDKS