TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M1VB74|M1VB74_CYAME Uncharacterized protein OS=Cyanidioschyzon merolae strain 10D GN=CYME_CMF138C PE=4 SV=1
MMPYVFACGTKDDVCLSRARGLVAGGACEIGDALGARCLSFCGVSAQGLINSKHAPEAAYSRRCGARGSNWTKRSARLVR
RSRMHLGESPVPTLPVPVAATRSTRESVSVETRKKSPLSVKLQCRVSTIAPLHRPWSMGLQEFPESRVRSMGTALGRHRS
LKLCAAASDTARFSSAQVSKHRRSMEYVFRLEVVRASLIAVWEMSLFLMTGYLLHRTHILDPQTVQGLSKAVYHIFLPAL
CFVNISAHVASSGHTSMLPLFFAAFLHIIAGIAAGELLSALLQVSSNKRRFIRIACGFGNSTSLPGLFYSSIFASDPSRA
TSSLGLMSIYCITWTAAFWPYLHANFGAPNVENAQQLEGTKTGAPDMDPQRSGDPPKYEATSKILHSGLYTVAIRRIGSL
IYALGTPPAFASIIGLLCGLVAPLRNLLFQNNHVLSVGLVLTVKSLAAANGACAMLVLAASLASRPGHGSSARYSFVARN
GSSTTASHPTKLFLPLSFIVGLYQRALRLLGSADFEIVVPALITRCILLPCLTFALIFPLADAFGLIPAGPTGTLMRFVM
ILQAVMPPAQNIVVGLQLEGDADEAAYAGRQLLVTYLLSLIPLCILLTLFLGILNV