TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M2RIY9|M2RIY9_CERS8 Uncharacterized protein OS=Ceriporiopsis subvermispora (strain B) GN=CERSUDRAFT_93950 PE=4 SV=1
MRKPSLSLVFLPLASTLLAAARLHHSLVPEDPYAFPKYRVTFLNGLPLSNETAQRWLQEGLRGGELEFTDQPWKDQQVPT
PHLKSIGAGQGQQDTVSVPDPNPSFASNYTLERMKLGPGLSYLCLIPPPPEDTPLPADEPEIDITPVHSWSLLQPLAGTC
LYHKQAWFTYAYCHNSHVRQFHELPHQHPHRPGEYRPVEDTEWEAYTLGKAPPSLEGGADLTVAEEAAVAANIELARGAG
SRYLVQRWGDGTYCDKTGKSREIEVQFHCSMTMTDTILFVKETQTCHYVLHIATPRLCGEPGFKSRGDTREEAYIRCREI
VSDAEYAHADRTLPPADHPVKLPKHRKPVIAPPPEEAPQDTKPAKPQSDIIRRALERILGRANLGSDMSGQVFVEQLDDG
DGEIMIELVDTEFPLEGDDDEGTDSRASHLADVLRAAGYDIVGQKASQAQEDESEKRKQRRDEL