TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M2XQQ8|M2XQQ8_GALSU ATP synthase protein I-like protein OS=Galdieria sulphuraria GN=Gasu_63810 PE=4 SV=1
MWMAFSSPSSLLLCIHKRQELYRSSSFLRKKRQGIRTVTLSSISKKDKGKNDWGFRPPDIPTLEERYRAELAYVEEKFGP
KRYETPELRDPLKTRILTNQEKAKQERSRGIKQYQDIKRILFGATLGVGAFLIPLLGWLGSGKIACSYAFGLGGSLIYVW
LLSRSVERLASSSTQSFRDWLGPARLAIVALLILTVSKHREELELLPVFLGFLTYKVATFFPLLLENWNQDNSSEVDSSK
NSVKKQATDSSSLVI