TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M2Y919|M2Y919_GALSU Uncharacterized protein OS=Galdieria sulphuraria GN=Gasu_03530 PE=4 SV=1
MFIGCCCNRSCIGFARPGRYGYFKPASIVFGGFRLLRSHLKLNLCCSLKRAERYTSSDWSRCLLSLPKSIILSRIRSHLF
WTCCVSFLVSLFDHFFKVPPFNPIPHTLLGSAMGLLLVFRTNAAYDRFWEARKLVGVLAVQSREMTRCIHSYFNEEKFQV
IKIRLVMLLKLFLVAFLQHVQGTADVVSFRKMIRSNPEYSDSSSHFVDIFADEIVHSPNPPLFVLFQLSMQIKAAFRETT
NVSDWVVQRAKMEWQLSSLMEVLSGCERIITTPVPLGYSRHTSRFLSLWCFTFPLLVVSHFKFLTVPVTAFVCWSLFAIE
EIGHVIEDPFLEGTQKLPIKSMISSLLADVDYVNHLPVFFS