TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M3A107|M3A107_9NOCA Uncharacterized protein OS=Rhodococcus ruber BKS 20-38 GN=G352_04186 PE=4 SV=1
MLRDRRILAAAAVLAVLALVALLLPHPSVAEVRAWAEAAGPLLPLLFFLIHAVVTVAPFPRTVFTLSAGVLFGSVTGIAV
TVAATTVSAVLALLLVRAIGRGVVETHLSHPTAQAVDERLARRGWLAVGSLRLIAPLPFAVVNYCCGISSVRVAPYTLAT
AAGILPGTIGVVLLGDALTGRTHPALLGISAVCIAVGASGLWLESRLPAPRPTTATAPSSPEA