TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M3B575|M3B575_STRMB Uncharacterized protein OS=Streptomyces mobaraensis NBRC 13819 = DSM 40847 GN=H340_07638 PE=4 SV=1
MAQAASLEKVELPDLPALREHQYVIAAFTGDGSLPVAVAPVGVGDRQAKADVAAALAKWRKWRELSPYQPNAKSKVGPEE
VTHVKGVKRTKQTYSLTKNPEEAITFDPNVSMCFPGAIVQAKPAIENGYLIPAGIEDSDRADLGITVDRLTSRKETASPP
SASNVTAAIGKVVGDDAPGSSDVVFRRVEAYDSSETALELGISAKYGGFAASLDISARRKETMNTVLVYLRERGFTAFCD
VSTPGALFKDSFTEEKLNKLVSGGYMGPDNPPLLVNSVVYGRIIVFTFTSTSSETEIKAALEASYHGFADVDAHLKAHYL
GIISKSEVSIISKGSTGGQIKELLTKGTLAESFATPQKYKSYVRIGYTLQTLDGIPAKMSETTNYDAVVWGDSTVTLKVK
SLGTPFGTRESFDITIDGQELPGASGHPATAYRAFAEDGSGDPYRITCMKYPVIGTTDTEAHVDWRLSPKELGWFAGGTT
TASGRYPETGNVWMDYEAVKDGNS